PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G380400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 343aa    MW: 37564.1 Da    PI: 7.0715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G380400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
  Aqcoe1G380400.1.p 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                       89********************************************97 PP

2Myb_DNA-binding445.2e-1468110246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g + + E++ +v+++   G++ W++Ia+ ++ gRt++++k++w++
  Aqcoe1G380400.1.p  68 GEFQESEEQTIVKLHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 110
                        678899***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.617965IPR017930Myb domain
SuperFamilySSF466897.86E-2911108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002493.4E-171461IPR001005SANT/Myb domain
CDDcd001679.50E-131761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129419.56766116IPR017930Myb domain
SMARTSM007176.2E-1366114IPR001005SANT/Myb domain
PfamPF002492.1E-1268110IPR001005SANT/Myb domain
CDDcd001671.13E-972112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF QESEEQTIVK LHSVVGNRWS LIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL APPQVAHLTE AALGCFKDEM LHLLTKKRVD FQMEHSNGAA  180
PHGLAPLPGR NFTTSYASRR PSDEDDTVQK IKLSVSRAMQ DPNTLPSEPN IAPSNKPWTM  240
VSIGEASNTF AEAYNTFATS VSGFPYGPSS CGNDGDGSPW NQSICTGSTC TGADQRLGLN  300
GKGGHEDGDE AEGGKGMRKD SDVFNSDCVL WDLTDDLMNP AA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347413e-37KM034741.1 Jatropha curcas clone JcMYB122 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244825.10.0PREDICTED: transcription factor MYB28
SwissprotQ7XQN11e-125MYB80_ORYSJ; Transcription factor MYB80
TrEMBLM5WEW71e-179M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t011e-178(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-117myb domain protein 103